Recombinant FGF-21 (Fibroblast growth factor-21), Mouse
CAT#: TP728319M
Recombinant FGF-21 (Fibroblast growth factor-21), Mouse
|
Need it in bulk or customized? Get a free quote |
CNY 4880.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS with polyhistidine tag at the N-terminus
|
| Tag | His Tag (N-term) |
| Predicted MW | The protein has a calculated MW of 20.76 kDa. The protein migrates as 25-35 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce proliferation in NIH‑3T3 mouse embryonic fibroblast cells in the presence of mouse Klotho beta and heparin. The ED₅₀ for this effect is < 2 μg/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | Q9JJN1 |
| Synonyms | Fgf8c |
| Summary | Fibroblast Growth Factors 21 (FGF-21) is a 23 kDa protein with 210 amino acid residues. Belongs to FGF superfamily, FGF-21 is related to glucose and lipid metabolism. Peroxisome proliferator-activated receptor gamma (PPARg) and peroxisome proliferator-activated receptor alpha (PPARa) regulate FGF-21 expression. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
