Recombinant IL-36 gamma (Interleukin-36 gamma), Mouse

CAT#: TP728357L

Recombinant IL-36 gamma (Interleukin-36 gamma), Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 22000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MGRETPDFGEVFDLDQQVWIFRNQALVTVPRSHRVTPVSVTILPCKYPESLEQDKGIAIYLGIQNPDKCLFCKEVNGHPTLLLKEEKILDLYHHPEPMKPFLFYHTRTGGTSTFESVAFPGHYIASSKTGNPIFLTSKKGEYYNINFNLDIKS with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 18.27 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 gamma is > 6 x 10⁴ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID Q8R460
Synonyms interleukin 1 family, member 9, IL-1F9,Il36g
Summary Interleukin 36 gamma (IL-36 gamma) is a 17.65 kDa cytokine with 159 amino acid residues. IL-36 gamma is a member of the IL-1 family and is mainly expressed in keratinocytes, bronchial epithelial cells, macrophages, and monocyte. This cytokine responds to multiple pathogen-associated molecular patterns (PAMPs) and participates in the inflammatory response. In addition, it also induces the production of pro-inflammatory cytokines like IL-12, IL-1β, IL-6, TNF-α, and IL-23.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...