Recombinant M-CSF (Macrophage colony-stimulating factor), Mouse
CAT#: TP728366
Recombinant M-CSF (Macrophage colony-stimulating factor), Mouse
|
Need it in bulk or customized? Get a free quote |
CNY 1890.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP withpolyhistidine tag at the C-terminus
|
| Tag | His Tag (C-term) |
| Predicted MW | The protein has a calculated MW of 19.02 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce proliferation in NFS-60 cells. The ED₅₀ for this effect is <2 ng/mL. The specific activity of recombinant mouse M-CSF is approximately >5 x 10⁵ IU/mg. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P07141 |
| Synonyms | CSF-1, MGI-IM |
| Summary | Macrophage Colony-Stimulating Factor (M-CSF) is a 19.02 kDa hematopoietic Growth Factors with 162 amino acid residues. The active form of the protein is homodimer, and secreted by osteoblasts. M-CSF controls the production, differentiation, and function of monocytes, macrophages, and bone marrow progenitor cells. M-CSF is able to activate CSF-1 signaling pathway via binding its receptor CSF-1R. |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
