Recombinant OX40L, Mouse
CNY 700.00
货期*
2周
规格
Specifications
| Product Data | |
| Species | Mouse |
| Expression Host | E. coli |
| Expression cDNA Clone or AA Sequence |
QLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL with polyhistidine tag at the N-terminus.
|
| Tag | His Tag (N-term) |
| Predicted MW | The protein has a calculated MW of 17.68 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >95% as determined by SDS-PAGE. |
| Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
| Applications | Cell culture |
| Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
| Bioactivity | Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED₅₀ for this effect is <25 ng/mL. |
| Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
| Reference Data | |
| UniProt ID | P43488 |
| Synonyms | TNFSF4,Ath, Ath-, Ath-1, Ath1, CD134, CD134L, OX-40L, OX4, TXGP1, Tnlg2b, Txgp, Txgp1l, gp3, gp34 |
| Summary | OX40L is a 16.86 kDa tumor necrosis factor family protein with 150 amino acid residues. OX40L is mainly expressed from lymphoid tissue, and promotes T-cell proliferation, survival, activation and cytokine production through receptor binding on the surface of T cells (OX40). |
Documents
| FAQs |
| SDS |
Customer
Reviews
Loading...
