Thyrotropin Releasing Hormone (TRH) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRH antibody: synthetic peptide directed towards the C terminal of human TRH. Synthetic peptide located within the following region: RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	thyrotropin releasing hormone
Database Link	NP_009048 Entrez Gene 7200 Human UniProt ID P20396
Background	TRH functions as a regulator of the biosynthesis of TSH in the anterior pituitary gland and as a neurotransmitter/ neuromodulator in the central and peripheral nervous systems.
Synonyms	Pro-TRH; TRF
Note	Immunogen sequence homology: Bovine: 100%; Human: 100%; Zebrafish: 92%; Guinea pig: 84%; Chicken: 78%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.