Thyrotropin Releasing Hormone (TRH) (NM_007117) Human Recombinant Protein
CAT#: TP319231
Recombinant protein of human thyrotropin-releasing hormone (TRH), 20 µg
View other "Thyrotropin Releasing Hormone" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219231 protein sequence
Red=Cloning site Green=Tags(s) MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVERLLFLRENIQRLQGDQGEHS ASQIFQSDWLSKRQHPGKREEEEEEGVEEEEEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRR SPWLAYAVPKRQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQGAYGQAGLLL GLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Cell treatment (PMID: 27806289) |
Reference Data | |
RefSeq | NP_009048 |
Locus ID | 7200 |
UniProt ID | P20396 |
Refseq Size | 1890 |
Cytogenetics | 3q22.1 |
Refseq ORF | 726 |
Synonyms | Pro-TRH; TRF |
Summary | This gene encodes a member of the thyrotropin-releasing hormone family. Cleavage of the encoded proprotein releases mature thyrotropin-releasing hormone, which is a tripeptide hypothalamic regulatory hormone. The human proprotein contains six thyrotropin-releasing hormone tripeptides. Thyrotropin-releasing hormone is involved in the regulation and release of thyroid-stimulating hormone, as well as prolactin. Deficiency of this hormone has been associated with hypothalamic hypothyroidism. [provided by RefSeq, May 2013] |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Vulnerability of Purkinje Cells Generated from Spinocerebellar Ataxia Type 6 Patient-Derived iPSCs
,Ishida, Y;Kawakami, H;Kitajima, H;Nishiyama, A;Sasai, Y;Inoue, H;Muguruma, K;,
Cell Rep
,PubMed ID 27806289
[TRH]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416185 | TRH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416185 | Transient overexpression lysate of thyrotropin-releasing hormone (TRH) |
CNY 3080.00 |
|
PH319231 | TRH MS Standard C13 and N15-labeled recombinant protein (NP_009048) |
CNY 19520.00 |
其它Thyrotropin Releasing Hormone产品