RUFY1 Rabbit Polyclonal Antibody
CAT#: TA330472
Rabbit Polyclonal Anti-RUFY1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-RUFY1 antibody: synthetic peptide directed towards the C terminal of human RUFY1. Synthetic peptide located within the following region: QCEKEFSISRRKHHCRNCGHIFCNTCSSNELALPSYPKPVRVCDSCHTLL |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 69 kDa |
| Gene Name | RUN and FYVE domain containing 1 |
| Database Link | |
| Background | RUFY1 contains 1 FYVE-type zinc finger and 1 RUN domain. It binds phospholipid vesicles containing phosphatidylinositol 3-phosphate and participates in early endosomal trafficking. |
| Synonyms | RABIP4; ZFYVE12 |
| Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Horse: 93%; Bovine: 85% |
| Reference Data | |
| Protein Pathways | Endocytosis |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
