SH3D20 Rabbit Antibody

Specifications

Product Data
Reactivity	Human, Mouse, Rat, Dog, Pig, Horse, Rabbit, Bovine
Host	Rabbit
Immunogen	The immunogen for Anti-ARHGAP27 Antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGAP27. Synthetic peptide located within the following region: GVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPS
Isotype	IgG
Formulation	Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Database Link	NP_954976 Entrez Gene 201176 Human
Background	Rho-like small GTPases are involved in many cellular processes, and they are inactive in the GDP-bound state and active in the GTP-bound state. GTPase-activating proteins, such as ARHGAP27, inhibit Rho-like proteins by stimulating their intrinsic GTPase activity.
Synonyms	CAMGAP1; PP905; SH3D20; SH3P20
Note	Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.