SH3D20 Rabbit Antibody
CAT#: TA331509
Rabbit Polyclonal Anti-ARHGAP27 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
CNY 4840.00
Specifications
| Product Data | |
| Reactivity | Human, Mouse, Rat, Dog, Pig, Horse, Rabbit, Bovine |
| Host | Rabbit |
| Immunogen | The immunogen for Anti-ARHGAP27 Antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGAP27. Synthetic peptide located within the following region: GVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPS |
| Isotype | IgG |
| Formulation | Shipped as lyophilized powder. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 60 kDa |
| Database Link | |
| Background | Rho-like small GTPases are involved in many cellular processes, and they are inactive in the GDP-bound state and active in the GTP-bound state. GTPase-activating proteins, such as ARHGAP27, inhibit Rho-like proteins by stimulating their intrinsic GTPase activity. |
| Synonyms | CAMGAP1; PP905; SH3D20; SH3P20 |
| Note | Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
