SH3D20 (ARHGAP27) (NM_199282) Human Recombinant Protein
CAT#: TP322412
Recombinant protein of human Rho GTPase activating protein 27 (ARHGAP27), 20 µg
View other "SH3D20" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC222412 protein sequence
Red=Cloning site Green=Tags(s) MQPGLSPGSPGDPRPPTPETDYPESLTSYPEEDYSPVGSFGEPGPTSPLTTPPGWSCHVSQDKQMLYTNH FTQEQWVRLEDPHGKPYFYNPEDSSVRWELPQVPVPAPRSIHKSSQDGDTPAQASPPEEKVPAELDEVGS WEEVSPATAAVRTKTLDKAGVLHRTKTADKGKRLRKKHWSASWTVLEGGVLTFFKDSKTSAAGGLRQPSK FSTPEYTVELRGATLSWAPKDKSSRKNVLELRSRDGSEYLIQHDSEAIISTWHKAIAQGIQELSAELPPE ESESSRVDFGSSERLGSWQEKEEDARPNAAAPALGPVGLESDLSKVRHKLRKFLQRRPTLQSLREKGYIK DQVFGCALAALCERERSRVPRFVQQCIRAVEARGLDIDGLYRISGNLATIQKLRYKVDHDERLDLDDGRW EDVHVITGALKLFFRELPEPLFPFSHFRQFIAAIKLQDQARRSRCVRDLVRSLPAPNHDTLRMLFQHLCR VIEHGEQNRMSVQSVAIVFGPTLLRPEVEETSMPMTMVFQNQVVELILQQCADIFPPH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 61.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_954976 |
| Locus ID | 201176 |
| UniProt ID | Q6ZUM4 |
| Refseq Size | 3654 |
| Cytogenetics | 17q21.31 |
| Refseq ORF | 1644 |
| Synonyms | CAMGAP1; PP905; SH3D20; SH3P20 |
| Summary | This gene encodes a member of a large family of proteins that activate Rho-type guanosine triphosphate (GTP) metabolizing enzymes. The encoded protein may pay a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Aug 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404604 | ARHGAP27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC406401 | ARHGAP27 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404604 | Transient overexpression lysate of Rho GTPase activating protein 27 (ARHGAP27), transcript variant 1 |
CNY 4840.00 |
|
| LY406401 | Transient overexpression lysate of SH3 domain containing 20 (SH3D20) |
CNY 3080.00 |
|
| PH322412 | ARHGAP27 MS Standard C13 and N15-labeled recombinant protein (NP_954976) |
CNY 19520.00 |
