IGFBPL1 Rabbit Polyclonal Antibody
CAT#: TA334311
Rabbit Polyclonal Anti-IGFBPL1 Antibody
Need it in bulk or conjugated? 
                            Get a free quote
                        
CNY 4628.00
CNY 3080.00
                                                
                                                
                                                
                                                    CNY 300.00 
                                                    
                                                    CNY 1430.00
                                                
                                            
                                                
                                                
                                                
                                                    CNY 2900.00 
                                                    
                                                    CNY 6650.00
                                                
                                            
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB | 
| Recommend Dilution | WB | 
| Reactivity | Human | 
| Host | Rabbit | 
| Clonality | Polyclonal | 
| Immunogen | The immunogen for anti-IGFBPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human IGFBPL1. Synthetic peptide located within the following region: WRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKED | 
| Isotype | IgG | 
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.  | 
        
| Purification | Affinity Purified | 
| Conjugation | Unconjugated | 
| Storage Condition | Store at -20°C as received. | 
| Predicted Protein Size | 26 kDa | 
| Gene Name | insulin like growth factor binding protein-like 1 | 
| Database Link | |
| Background | IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors. IGFBPL1 may be a putative tumor suppressor protein. | 
| Synonyms | bA113O24.1; IGFBP-RP4; IGFBPRP4 | 
| Note | Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Dog: 79%; Bovine: 79%; Rabbit: 79% | 
| Reference Data | |
Documents
| Product Manuals | 
| FAQs | 
| SDS | 
Resources
| 抗体相关资料 | 
其它IGFBPL1产品
