IGFBPL1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IGFBPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human IGFBPL1. Synthetic peptide located within the following region: WRKVTKSPEGTQALEELPGDHVNIAVQVRGGPSDHEATAWILINPLRKED
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	insulin like growth factor binding protein-like 1
Database Link	NP_001007564 Entrez Gene 347252 Human UniProt ID Q8WX77
Background	IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors. IGFBPL1 may be a putative tumor suppressor protein.
Synonyms	bA113O24.1; IGFBP-RP4; IGFBPRP4
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Horse: 86%; Dog: 79%; Bovine: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.