IGFBPL1 (NM_001007563) Human Recombinant Protein
CAT#: TP319122
Recombinant protein of human insulin-like growth factor binding protein-like 1 (IGFBPL1), 20 µg
View other "IGFBPL1" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219122 representing NM_001007563
Red=Cloning site Green=Tags(s) MPRLSLLLPLLLLLLLPLLPPLSPSLGIRDVGGRRPKCGPCRPEGCPAPAPCPAPGISALDECGCCARCL GAEGASCGGRAGGRCGPGLVCASQAAGAAPEGTGLCVCAQRGTVCGSDGRSYPSVCALRLRARHTPRAHP GHLHKARDGPCEFAPVVVVPPRSVHNVTGAQVGLSCEVRAVPTPVITWRKVTKSPEGTQALEELPGDHVN IAVQVRGGPSDHEATAWILINPLRKEDEGVYQCHAANMVGEAESHSTVTVLDLSKYRSFHFPAPDDRM myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001007564 |
Locus ID | 347252 |
UniProt ID | Q8WX77 |
Refseq Size | 1093 |
Cytogenetics | 9p13.1 |
Refseq ORF | 834 |
Synonyms | bA113O24.1; IGFBP-RP4; IGFBPRP4 |
Summary | IGF-binding proteins prolong the half-life of IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs in cell culture. They alter the interaction of IGFs with their cell surface receptors (By similarity). May be a putative tumor suppressor protein.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC423513 | IGFBPL1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY423513 | Transient overexpression lysate of insulin-like growth factor binding protein-like 1 (IGFBPL1) |
CNY 3080.00 |
|
PH319122 | IGFBPL1 MS Standard C13 and N15-labeled recombinant protein (NP_001007564) |
CNY 19520.00 |
其它IGFBPL1产品