OBP2A Rabbit Polyclonal Antibody

CAT#: TA334553

Rabbit Polyclonal Anti-OBP2A Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human odorant binding protein 2A (OBP2A), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of odorant binding protein 2A (OBP2A)
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-OBP2A antibody is: synthetic peptide directed towards the middle region of Human OBP2A. Synthetic peptide located within the following region: QKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYM
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 25 kDa
Gene Name odorant binding protein 2A
Background This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined.
Synonyms hOBPIIa; LCN13; OBP; OBP2C; OBPIIa
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...