OBP2A (NM_014582) Human Recombinant Protein
CAT#: TP310114
Recombinant protein of human odorant binding protein 2A (OBP2A), 20 µg
View other "OBP2A" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210114 representing NM_014582
Red=Cloning site Green=Tags(s) MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMR EDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEAL EEFKKLVQHKGLSEEDIFMPLQTGSCVLEH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055397 |
Locus ID | 29991 |
UniProt ID | Q9NY56 |
Refseq Size | 689 |
Cytogenetics | 9q34.3 |
Refseq ORF | 510 |
Synonyms | hOBPIIa; LCN13; OBP; OBP2C; OBPIIa |
Summary | This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415182 | OBP2A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415182 | Transient overexpression lysate of odorant binding protein 2A (OBP2A) |
CNY 3080.00 |
|
PH310114 | OBP2A MS Standard C13 and N15-labeled recombinant protein (NP_055397) |
CNY 19520.00 |