RGS19 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RGS19 antibody is: synthetic peptide directed towards the N-terminal region of Human RGS19. Synthetic peptide located within the following region: PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	regulator of G-protein signaling 19
Database Link	NP_005864 Entrez Gene 10287 Human UniProt ID P49795
Background	G proteins mediate a number of cellular processes. RGS19 belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling.
Synonyms	GAIP; RGSGAIP
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Dog: 85%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.