RGS19 (NM_001039467) Human Recombinant Protein
CAT#: TP301715
Recombinant protein of human regulator of G-protein signaling 19 (RGS19), transcript variant 2, 20 µg
View other "RGS19" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201715 protein sequence
Red=Cloning site Green=Tags(s) MPTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSWNQERRRAWQASRESKLQPL PSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKAR LIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGP SQSSSEA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001034556 |
Locus ID | 10287 |
UniProt ID | P49795 |
Refseq Size | 1493 |
Cytogenetics | 20q13.33 |
Refseq ORF | 651 |
Synonyms | GAIP; RGSGAIP |
Summary | G proteins mediate a number of cellular processes. The protein encoded by this gene belongs to the RGS (regulators of G-protein signaling) family and specifically interacts with G protein, GAI3. This protein is a guanosine triphosphatase-activating protein that functions to down-regulate Galpha i/Galpha q-linked signaling. Alternatively spliced transcript variants encoding the same protein isoform have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417015 | RGS19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422051 | RGS19 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417015 | Transient overexpression lysate of regulator of G-protein signaling 19 (RGS19), transcript variant 1 |
CNY 3080.00 |
|
LY422051 | Transient overexpression lysate of regulator of G-protein signaling 19 (RGS19), transcript variant 2 |
CNY 3080.00 |
|
PH301715 | RGS19 MS Standard C13 and N15-labeled recombinant protein (NP_001034556) |
CNY 19520.00 |
|
PH309082 | RGS19 MS Standard C13 and N15-labeled recombinant protein (NP_005864) |
CNY 19520.00 |
|
TP309082 | Recombinant protein of human regulator of G-protein signaling 19 (RGS19), transcript variant 1, 20 µg |
CNY 2900.00 |