RFX5 Rabbit Polyclonal Antibody

CAT#: TA335175

Rabbit Polyclonal Anti-RFX5 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4537.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 1
    • 100 ug

CNY 3080.00


Recombinant protein of human regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2
    • 100 ug

CNY 4840.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-RFX5 antibody: synthetic peptide directed towards the N terminal of human RFX5. Synthetic peptide located within the following region: MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGIL
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 68 kDa
Gene Name regulatory factor X5
Background RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. RFX is a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX.A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX.A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX (Steimle et al., 1995). RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. Multiple alternatively spliced transcript variants have been found but the full-length natures of only two have been determined.
Synonyms 5; 5 (influences HLA class II expression); OTTHUMP00000082795; OTTHUMP00000196318; regulatory factor X
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Horse: 86%; Rabbit: 86%; Rat: 79%; Guinea pig: 79%
Reference Data
Protein Families Transcription Factors
Protein Pathways Antigen processing and presentation, Primary immunodeficiency
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...