RFX5 (NM_001025603) Human Recombinant Protein
CAT#: TP312448
Recombinant protein of human regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2, 20 µg
View other "RFX5" proteins (6)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC212448 representing NM_001025603
Red=Cloning site Green=Tags(s) MAEDEPDAKSPKTGGRAPPGGAEAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLPS GPTTGDKSSEPSTLSNEEYMYAYRWIRNHLEEHTDTCLPKQSVYDAYRKYCESLACCRPLSTANFGKIIR EIFPDIKARRLGGRGQSKYCYSGIRRKTLVSMPPLPGLDLKGSESPEMGPEVTPAPRDELVEAACALTCD WAERILKRSFSSIVEVARFLLQQHLISARSAHAHVLKAMGLAEEDEHAPRERSSKPKNGLENPEGGAHKK PERLAQPPKDLEARTGAGPLARGERKKSVVESSAPGANNLQVNALVARLPLLLPRAPRSLIPPIPVSPPI LAPRLSSGALKVATLPLSSRAGAPPAAVPIINMILPTVPALPGPGPGPGRAPPGGLTQPRGTENREVGIG GDQGPHDKGVKRTAEVPVSEASGQAPPAKAAKQDIEDTASDAKRKRGRPRKKSGGSGERNSTPLKSAAAM ESAQSSRLPWETWGSGGEGNSAGGAERPGPMGEAEKGAVLAQGQGDGTVSKGGRGPGSQHTKEAEDKIPL VPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDPKATPP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 65.1 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001020774 |
| Locus ID | 5993 |
| UniProt ID | P48382 |
| Refseq Size | 3611 |
| Cytogenetics | 1q21.3 |
| Refseq ORF | 1848 |
| Summary | A lack of MHC-II expression results in a severe immunodeficiency syndrome called MHC-II deficiency, or the bare lymphocyte syndrome (BLS; MIM 209920). At least 4 complementation groups have been identified in B-cell lines established from patients with BLS. The molecular defects in complementation groups B, C, and D all lead to a deficiency in RFX, a nuclear protein complex that binds to the X box of MHC-II promoters. The lack of RFX binding activity in complementation group C results from mutations in the RFX5 gene encoding the 75-kD subunit of RFX (Steimle et al., 1995). RFX5 is the fifth member of the growing family of DNA-binding proteins sharing a novel and highly characteristic DNA-binding domain called the RFX motif. Multiple alternatively spliced transcript variants have been found but the full-length natures of only two have been determined. [provided by RefSeq, Jul 2008] |
| Protein Families | Transcription Factors |
| Protein Pathways | Antigen processing and presentation, Primary immunodeficiency |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC422455 | RFX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC424713 | RFX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY422455 | Transient overexpression lysate of regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 2 |
CNY 4840.00 |
|
| LY424713 | Transient overexpression lysate of regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 1 |
CNY 3080.00 |
|
| PH312448 | RFX5 MS Standard C13 and N15-labeled recombinant protein (NP_001020774) |
CNY 19520.00 |
|
| TP761917 | Purified recombinant protein of Human regulatory factor X, 5 (influences HLA class II expression) (RFX5), transcript variant 1, Leu391-Pro616, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2040.00 |
