DSCC1 Rabbit Polyclonal Antibody
CAT#: TA335474
Rabbit Polyclonal Anti-DSCC1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-DSCC1 Antibody is: synthetic peptide directed towards the middle region of Human DSCC1. Synthetic peptide located within the following region: MENPYEGPDSQKEKDSNSSKYTTEDLLDQIQASEEEIMTQLQVLNACKIG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 44 kDa |
Gene Name | DNA replication and sister chromatid cohesion 1 |
Database Link | |
Background | CHTF18, CHTF8, and DSCC1 are components of an alternative replication factor C (RFC) complex that loads PCNA onto DNA during S phase of the cell cycle. |
Synonyms | DCC1 |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 90%; Horse: 86%; Bovine: 86%; Mouse: 85% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |