SERPINB2 Rabbit Polyclonal Antibody

CAT#: TA337675

Rabbit Polyclonal Anti-SERPINB2 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5200.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 1
    • 100 ug

CNY 3080.00


Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 2 (SERPINB2), transcript variant 2
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SERPINB2 antibody: synthetic peptide directed towards the middle region of human SERPINB2. Synthetic peptide located within the following region: GKIPNLLPEGSVDGDTRMVLVNAVYFKGKWKTPFEKKLNGLYPFRVNSAQ
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 44 kDa
Gene Name serpin family B member 2
Background SERPINB2 inhibits urokinase-type plasminogen activator. The monocyte derived PAI-2 is distinct from the endothelial cell-derived PAI-1.
Synonyms HsT1201; PAI; PAI-2; PAI2; PLANH2
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Sheep: 86%; Bovine: 86%; Rat: 85%
Reference Data
Protein Families Druggable Genome, Secreted Protein
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...