MBNL2 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-MBNL2 antibody: synthetic peptide directed towards the middle region of human MBNL2. Synthetic peptide located within the following region: ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAA |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Purification | Protein A purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 28 kDa |
| Database Link | |
| Background | MBNL2 is a C3H-type zinc finger protein, which is similar to the Drosophila melanogaster muscleblind B protein.MBNL2 is a RNA-binding protein that binds to 5'ACACCC-3' core sequence. It binds to CUG triplet repeat expansion in myotonic dystrophy muscle cells by sequestering the target RNAs. MBNL2 seems to regulate expression and localization of ITGA3 by transporting it from the nucleus to cytoplasm. It may play a role in myotonic dystrophy pathophysiology (DM). |
| Synonyms | DKFZp781H1296; MBLL; MBLL39; MGC120625; MGC120626; MGC120628; muscleblind-like 2; muscleblind-like 2 (Drosophila); OTTHUMP00000018578; OTTHUMP00000040762; OTTHUMP00000178763; PRO2032 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Zebrafish: 93% |
| Reference Data | |
| Protein Families | Transcription Factors |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
