MBNL2 (NM_207304) Human Recombinant Protein
CAT#: TP319730
Recombinant protein of human muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 3, 20 µg
View other "MBNL2" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC219730 protein sequence
Red=Cloning site Green=Tags(s) MALNVAPVRDTKWLTLEVCRQFQRGTCSRSDEECKFAHPPKSCQVENGRVIACFDSLKGRCSRENCKYLH PPTHLKTQLEINGRNNLIQQKTAAAMLAQQMQFMFPGTPLHPVPTFPVGPAIGTNTAISFAPYLAPVTPG VGLVPTEILPTTPVIVPGSPPVTVPGSTATQKLLRTDKLEVCREFQRGNCARGETDCRFAHPADSTMIDT SDNTVTVCMDYIKGRCMREKCKYFHPPAHLQAKIKAAQHQANQAAVAAQAAAAAATVMAFPPGALHPLPK RQALEKSNGTSAVFNPSVLHYQQALTSAQLQQHAAFIPTDNSEIISRNGMECQESALRITKHCYCTYYPV SSSIELPQTAC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 39.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_997187 |
| Locus ID | 10150 |
| UniProt ID | Q5VZF2 |
| Refseq Size | 4624 |
| Cytogenetics | 13q32.1 |
| Refseq ORF | 1083 |
| Synonyms | MBLL; MBLL39; PRO2032 |
| Summary | This gene is a member of the muscleblind protein family which was initially described in Drosophila melanogaster. This gene encodes a C3H-type zinc finger protein that modulates alternative splicing of pre-mRNAs. Muscleblind proteins bind specifically to expanded dsCUG RNA but not to normal size CUG repeats and may thereby play a role in the pathophysiology of myotonic dystrophy. Several alternatively spliced transcript variants have been described but the full-length natures of only some have been determined. [provided by RefSeq, Mar 2012] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403412 | MBNL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC404083 | MBNL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403412 | Transient overexpression lysate of muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 1 |
CNY 3080.00 |
|
| LY404083 | Transient overexpression lysate of muscleblind-like 2 (Drosophila) (MBNL2), transcript variant 3 |
CNY 3080.00 |
|
| PH319730 | MBNL2 MS Standard C13 and N15-labeled recombinant protein (NP_997187) |
CNY 19520.00 |
