DHX35 Rabbit Polyclonal Antibody
CAT#: TA341617
Rabbit Polyclonal Anti-DHX35 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
CNY 9998.00
CNY 4840.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-DHX35 antibody: synthetic peptide directed towards the N terminal of human DHX35. Synthetic peptide located within the following region: MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | lot specific |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 79 kDa |
| Gene Name | DEAH-box helicase 35 |
| Database Link | |
| Background | DEAD box proteins characterized byThe conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based onTheir distribution patterns, some members ofThe DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division.The function ofThis gene product which is a member ofThis family, has not been determined. Alternatively spliced transcript variants have been found forThis gene. [provided by RefSeq, Jun 2010] |
| Synonyms | C20orf15; DDX35; KAIA0875 |
| Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 92% |
| Reference Data | |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
