DHX35 (NM_021931) Human Recombinant Protein
CAT#: TP314668
Recombinant protein of human DEAH (Asp-Glu-Ala-His) box polypeptide 35 (DHX35), 20 µg
View other "DHX35" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC214668 protein sequence
Red=Cloning site Green=Tags(s) MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQRQKLPVFKLRNHILYLIENY QTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVGVTQPRRVAAVTVAGRVAEERGAVLGHEVGYCIRFDD CTDQLATRIKFLTDGMLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKRGDLRLIVASAT LDADKFRDFFNQNETSDPARDTCVILTVEGRTFPVDIFYLQSPVPDYIKSTVETVVKIHQTEGDGDVLAF LTGQEEVETVVSMLIEQARALARTGMKRHLRVLPMYAGLPSFEQMKVFERVSRSVRKVIVATNVAETSIT ISGIVYVIDCGFVKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRSRSGKCYRLYTEEAFDKLPQSTVP EMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQALELLYALGGLDKDCRLTEPLGMRIAEFPLNP MFAKMLLESGNFGCSQEILSIAAMMQIQNIFVVPPNQKSHAIRVHRKFAVEEGDHLTMLNIYEAFIKHNK DSKWCQEHFLNYKGLVRAATVREQLKKLLVKFQVPRKSSEGDPDLVLRCIVSGFFANAARFHSTGAYRTI RDDHELHIHPASVLYAEKPPRWVIYNEVIQTSKYYMRDVTAIESAWLLELAPHFYQQGTHLSLKAKRAKV QDP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 78.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_068750 |
| Locus ID | 60625 |
| UniProt ID | Q9H5Z1 |
| Refseq Size | 3336 |
| Cytogenetics | 20q11.23-q12 |
| Refseq ORF | 2109 |
| Synonyms | C20orf15; DDX35; KAIA0875 |
| Summary | DEAD box proteins characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of the DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The function of this gene product which is a member of this family, has not been determined. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jun 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411896 | DHX35 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC434365 | DHX35 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY411896 | Transient overexpression lysate of DEAH (Asp-Glu-Ala-His) box polypeptide 35 (DHX35) |
CNY 4840.00 |
|
| LY434365 | Transient overexpression lysate of DEAH (Asp-Glu-Ala-His) box polypeptide 35 (DHX35), transcript variant 2 |
CNY 4840.00 |
|
| PH314668 | DHX35 MS Standard C13 and N15-labeled recombinant protein (NP_068750) |
CNY 19520.00 |
