MCM4 Rabbit Polyclonal Antibody

CAT#: TA341684

Rabbit Polyclonal Anti-MCM4 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4537.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human minichromosome maintenance complex component 4 (MCM4), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of minichromosome maintenance complex component 4 (MCM4), transcript variant 2
    • 100 ug

CNY 3080.00


Recombinant protein of human minichromosome maintenance complex component 4 (MCM4), transcript variant 1, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of minichromosome maintenance complex component 4 (MCM4), transcript variant 1
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the middle region of human MCM4. Synthetic peptide located within the following region: VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 95 kDa
Gene Name minichromosome maintenance complex component 4
Background The protein encoded byThis gene is one ofThe highly conserved mini-chromosome maintenance proteins (MCM) that are essential forThe initiation of eukaryotic genome replication.The hexameric protein complex formed by MCM proteins is a key component ofThe pre-replication complex (pre_RC) and may be involved inThe formation of replication forks and inThe recruitment of other DNA replication related proteins.The MCM complex consisting ofThis protein and MCM2, 6 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme.The phosphorylation ofThis protein by CDC2 kinase reducesThe DNA helicase activity and chromatin binding ofThe MCM complex.This gene is mapped to a region onThe chromosome 8 head-to-head next toThe PRKDC/DNA-PK, a DNA-activated protein kinase involved inThe repair of DNA double-strand breaks. Alternatively spliced transcript variants encodingThe same protein have been reported. [provided by RefSeq, Jul 2008]
Synonyms CDC21; CDC54; hCdc21; NKCD; NKGCD; P1-CDC21
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 85%
Reference Data
Protein Families Stem cell - Pluripotency, Transcription Factors
Protein Pathways Cell cycle, DNA replication
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...