KCNRG Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KCNRG antibody: synthetic peptide directed towards the N terminal of human KCNRG. Synthetic peptide located within the following region: MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIF
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	potassium channel regulator
Database Link	NP_775876 Entrez Gene 283518 Human UniProt ID Q8N5I3
Background	This gene encodes a protein which regulatesThe activity of voltage-gated potassium channels.This gene is on chromosome 13 and overlapsThe gene for tripartite motif containing 13 onThe same strand. Multiple transcript variants encoding different isoforms have been found forThis gene. [provided by RefSeq, Feb 2012]
Synonyms	DLTET
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.