KLRA1 (KLRA1P) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-KLRA1 antibody: synthetic peptide directed towards the N terminal of human KLRA1. Synthetic peptide located within the following region: NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	25 kDa
Gene Name	killer cell lectin like receptor A1, pseudogene
Database Link	NP_006602 Entrez Gene 10748 Human
Background	The function ofThe KLRA1 protein remains unknown.
Synonyms	A1; class I MHC receptor KLRA22; killer cell lectin-like receptor; KLRA#; Klra22; Ly-49L; Ly49; Ly49a; LY49L; Ly49o; Ly49v; member 1; MGC126520; MGC126522; natural killer cell receptor Ly49A; OTTMUSP00000026268; subfamily A
Note	Immunogen Sequence Homology: Human: 100%; Rat: 90%; Horse: 86%; Rabbit: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.