Nurim (NRM) Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-NRM antibody: synthetic peptide directed towards the N terminal of human NRM. Synthetic peptide located within the following region: MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGW |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 29 kDa |
Gene Name | nurim (nuclear envelope membrane protein) |
Database Link | |
Background | The protein encoded byThis gene contains transmembrane domains and resides withinThe inner nuclear membrane, where it is tightly associated withThe nucleus.This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012] |
Synonyms | NRM29 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Horse: 93%; Dog: 86%; Bovine: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |