Nurim (NRM) (NM_007243) Human Recombinant Protein
CAT#: TP308090
Recombinant protein of human nurim (nuclear envelope membrane protein) (NRM), 20 µg
View other "Nurim" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC208090 protein sequence
Red=Cloning site Green=Tags(s) MAPALLLIPAALASFILAFGTGVEFVRFTSLRPLLGGIPESGGPDARQGWLAALQDRSILAPLAWDLGLL LLFVGQHSLMAAERVKAWTSRYFGVLQRSLYVACTALALQLVMRYWEPIPKGPVLWEARAEPWATWVPLL CFVLHVISWLLIFSILLVFDYAELMGLKQVYYHVLGLGEPLALKSPRALRLFSHLRHPVCVELLTVLWVV PTLGTDRLLLAFLLTLYLGLAHGLDQQDLRYLRAQLQRKLHLLSRPQDGEAE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_009174 |
| Locus ID | 11270 |
| UniProt ID | Q8IXM6 |
| Refseq Size | 1767 |
| Cytogenetics | 6p21.33 |
| Refseq ORF | 786 |
| Synonyms | NRM29 |
| Summary | The protein encoded by this gene contains transmembrane domains and resides within the inner nuclear membrane, where it is tightly associated with the nucleus. This protein shares homology with isoprenylcysteine carboxymethyltransferase enzymes. Alternative splicing results in multiple transcript variants that encode different protein isoforms. [provided by RefSeq, Jul 2012] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416103 | NRM HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416103 | Transient overexpression lysate of nurim (nuclear envelope membrane protein) (NRM) |
CNY 3080.00 |
|
| PH308090 | NRM MS Standard C13 and N15-labeled recombinant protein (NP_009174) |
CNY 19520.00 |

