OSGIN1 Rabbit Polyclonal Antibody
CAT#: TA342142
Rabbit polyclonal Anti-OSGIN1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-OSGIN1 antibody: synthetic peptide directed towards the N terminal of human OSGIN1. Synthetic peptide located within the following region: APGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTW |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 61 kDa |
Gene Name | oxidative stress induced growth inhibitor 1 |
Database Link | |
Background | This gene encodes an oxidative stress response protein that regulates cell death. Expression ofThe gene is regulated by p53 and is induced by DNA damage.The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears to be a key regulator of both inflammatory and anti-inflammatory molecules.The loss ofThis protein correlates with uncontrolled cell growth and tumor formation. Naturally occurring read-through transcription exists betweenThis gene andThe neighboring upstream malonyl-CoA decarboxylase (MLYCD) gene, butThe read-through transcripts are unlikely to produce a protein product. [provided by RefSeq, Aug 2011] |
Synonyms | BDGI; OKL38 |
Note | Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Zebrafish: 79% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |