OSGIN1 (NM_013370) Human Recombinant Protein
CAT#: TP318475
Recombinant protein of human oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 1, 20 µg
View other "OSGIN1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218475 representing NM_013370
Red=Cloning site Green=Tags(s) MGKWRPRGCCRGNMQCRQEVPATLTSSELFSTRNQPQPQPQPLLADAPVPWAVASRMCLTPGQGCGHQGQ DEGPLPAPSPPPAMSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKL TEAPGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHVVLGRNLP GGAWHSIEGSMVILSQGQWMGLPDLEVKDWMQKKRRGLRNSRATAGDIAHYYRDYVVKKGLGHNFVSGAV VTAVEWGTPDPSSCGAQDSSPLFQVSGFLTRNQAQQPFSLWARNVVLATGTFDSPARLGIPGEALPFIHH ELSALEAATRVGAVTPASDPVLIIGAGLSAADAVLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEY HKVHQMMREQSILSPSPYEGYRSLPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIGSHPDLSFLPG AGADFAVDPDQPLSAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKETRKPP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 60.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_037502 |
| Locus ID | 29948 |
| UniProt ID | Q9UJX0 |
| Refseq Size | 2400 |
| Cytogenetics | 16q23.3 |
| Refseq ORF | 1680 |
| Synonyms | BDGI; OKL38 |
| Summary | This gene encodes an oxidative stress response protein that regulates cell death. Expression of the gene is regulated by p53 and is induced by DNA damage. The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears to be a key regulator of both inflammatory and anti-inflammatory molecules. The loss of this protein correlates with uncontrolled cell growth and tumor formation. Naturally occurring read-through transcription exists between this gene and the neighboring upstream malonyl-CoA decarboxylase (MLYCD) gene, but the read-through transcripts are unlikely to produce a protein product. [provided by RefSeq, Aug 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405295 | OSGIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC415630 | OSGIN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY405295 | Transient overexpression lysate of oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 3 |
CNY 3080.00 |
|
| LY415630 | Transient overexpression lysate of oxidative stress induced growth inhibitor 1 (OSGIN1), transcript variant 1 |
CNY 4840.00 |
|
| PH318475 | OSGIN1 MS Standard C13 and N15-labeled recombinant protein (NP_037502) |
CNY 14250.00 |
