Sts1 (UBASH3B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ubash3b antibody is: synthetic peptide directed towards the C-terminal region of Rat Ubash3b. Synthetic peptide located within the following region: AHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	ubiquitin associated and SH3 domain containing B
Database Link	NP_116262 Entrez Gene 315579 Rat UniProt ID Q8TF42
Background	The function of this protein remains unknown.
Synonyms	p70; STS-1; STS1; TULA-2; TULA2
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.