Sts1 (UBASH3B) (NM_032873) Human Recombinant Protein
CAT#: TP303523
Recombinant protein of human ubiquitin associated and SH3 domain containing, B (UBASH3B), 20 µg
View other "Sts1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. |
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC203523 protein sequence
Red=Cloning site Green=Tags(s) MAQYGHPSPLGMAAREELYSKVTPRRNRQQRPGTIKHGSALDVLLSMGFPRARAQKALASTGGRSVQAAC DWLFSHVGDPFLDDPLPREYVLYLRPTGPLAQKLSDFWQQSKQICGKNKAHNIFPHITLCQFFMCEDSKV DALGEALQTTVSRWKCKFSAPLPLELYTSSNFIGLFVKEDSAEVLKKFAADFAAEAASKTEVHVEPHKKQ LHVTLAYHFQASHLPTLEKLAQNIDVKLGCDWVATIFSRDIRFANHETLQVIYPYTPQNDDELELVPGDF IFMSPMEQTSTSEGWIYGTSLTTGCSGLLPENYITKADECSTWIFHGSYSILNTSSSNSLTFGDGVLERR PYEDQGLGETTPLTIICQPMQPLRVNSQPGPQKRCLFVCRHGERMDVVFGKYWLSQCFDAKGRYIRTNLN MPHSLPQRSGGFRDYEKDAPITVFGCMQARLVGEALLESNTIIDHVYCSPSLRCVQTAHNILKGLQQENH LKIRVEPGLFEWTKWVAGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEI ISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVRKIPYLGFCSCEELGETGIWQLTDPPIL PLTHGPTGGFNWRETLLQE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 72.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_116262 |
| Locus ID | 84959 |
| UniProt ID | Q8TF42 |
| Refseq Size | 6917 |
| Cytogenetics | 11q24.1 |
| Refseq ORF | 1947 |
| Synonyms | p70; STS-1; STS1; TULA-2; TULA2 |
| Summary | This gene encodes a protein that contains a ubiquitin associated domain at the N-terminus, an SH3 domain, and a C-terminal domain with similarities to the catalytic motif of phosphoglycerate mutase. The encoded protein was found to inhibit endocytosis of epidermal growth factor receptor (EGFR) and platelet-derived growth factor receptor. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Elucidation of protein interactions necessary for the maintenance of the BCR-ABL signaling complex.
,null,
Cellular and molecular life sciences : CMLS
,PubMed ID 31820037
[UBASH3B]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409906 | UBASH3B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409906 | Transient overexpression lysate of ubiquitin associated and SH3 domain containing, B (UBASH3B) |
CNY 3080.00 |
|
| PH303523 | UBASH3B MS Standard C13 and N15-labeled recombinant protein (NP_116262) |
CNY 19520.00 |
