ARPC2 Rabbit Polyclonal Antibody
CAT#: TA344279
Rabbit Polyclonal Anti-ARPC2 Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ARPC2 antibody: synthetic peptide directed towards the N terminal of human ARPC2. Synthetic peptide located within the following region: MVLNVYCCFFQISDIQTMKINQTILKEFILVGFSVYPHVQTFLFVVFFCL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 33 kDa |
Gene Name | actin related protein 2/3 complex subunit 2 |
Database Link | |
Background | ARPC2 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of ARPC2, the p34 subunit, has yet to be determined. This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p34 subunit, has yet to be determined. Two alternatively spliced variants have been characterized to date. Additional alternatively spliced variants have been described but their full length nature has not been determined. |
Synonyms | ARC34; p34-Arc; PNAS-139; PRO2446 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 86% |
Reference Data | |
Protein Pathways | Fc gamma R-mediated phagocytosis, Pathogenic Escherichia coli infection, Regulation of actin cytoskeleton |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |