LASS4 (CERS4) Rabbit Polyclonal Antibody
CAT#: TA345387
Rabbit Polyclonal Anti-LASS4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-LASS4 antibody: synthetic peptide directed towards the N terminal of human LASS4. Synthetic peptide located within the following region: MLSSFNEWFWQDRFWLPPNVTWTELEDRDGRVYPHPQDLLAALPLALVLL |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 46 kDa |
| Gene Name | ceramide synthase 4 |
| Database Link | |
| Background | LASS4 may be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells it is involved in the production of sphingolipids containing different fatty acid donnors (N-linked stearoyl- (C18) or arachidoyl- (C20) ceramides) in a fumonisin B1-independent manner. |
| Synonyms | LASS4; Trh1 |
| Note | Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Pig: 86%; Rat: 86%; Dog: 79%; Horse: 79% |
| Reference Data | |
| Protein Families | Transcription Factors, Transmembrane |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
