ALS (IGFALS) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IGFALS antibody: synthetic peptide directed towards the middle region of human IGFALS. Synthetic peptide located within the following region: PGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	insulin like growth factor binding protein acid labile subunit
Database Link	NP_004961 Entrez Gene 3483 Human UniProt ID P35858
Background	IGFALS is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in IGFALS are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty.
Synonyms	ACLSD; ALS
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%; Pig: 92%; Bovine: 92%; Guinea pig: 92%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.