ALS (IGFALS) (NM_004970) Human Recombinant Protein
CAT#: TP306542
Recombinant protein of human insulin-like growth factor binding protein, acid labile subunit (IGFALS), 20 µg
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC206542 protein sequence
Red=Cloning site Green=Tags(s) MALRKGGLALALLLLSWVALGPRSLEGADPGTPGEAEGPACPAACVCSYDDDADELSVFCSSRNLTRLPD GVPGGTQALWLDGNNLSSVPPAAFQNLSSLGFLNLQGGQLGSLEPQALLGLENLCHLHLERNQLRSLALG TFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWNSLAVLPDAAFRGLGSLRELVLAGNRLAYLQ PALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAG LLEDTFPGLLGLRVLRLSHNAIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQL QEVKAGAFLGLTNMAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDN GLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGPLQRAFWLDVS HNRLEALPNSLLAPLGRLRYLSLRNNSLRTFTPQPPGLERLWLEGNPWDCGCPLKALRDFALQNPSAVPR FVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAPC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004961 |
Locus ID | 3483 |
UniProt ID | P35858 |
Refseq Size | 2168 |
Cytogenetics | 16p13.3 |
Refseq ORF | 1815 |
Synonyms | ACLSD; ALS |
Summary | The protein encoded by this gene is a serum protein that binds insulin-like growth factors, increasing their half-life and their vascular localization. Production of the encoded protein, which contains twenty leucine-rich repeats, is stimulated by growth hormone. Defects in this gene are a cause of acid-labile subunit deficiency, which maifests itself in a delayed and slow puberty. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Mar 2009] |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
A draft map of the human ovarian proteome for tissue engineering and clinical applications
,Ouni, E;Vertommen, D;Chiti, MC;Dolmans, MM;Amorim, CA;,
Mol. Cell Proteomics
,PubMed ID 29475978
[IGFALS]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401546 | IGFALS HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401546 | Transient overexpression lysate of insulin-like growth factor binding protein, acid labile subunit (IGFALS), transcript variant 2 |
CNY 3080.00 |
|
PH306542 | IGFALS MS Standard C13 and N15-labeled recombinant protein (NP_004961) |
CNY 19520.00 |