DYNLRB1 (NM_014183) Human Mass Spec Standard
CAT#: PH300051
DYNLRB1 MS Standard C13 and N15-labeled recombinant protein (NP_054902)
View other "DYNLRB1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | DYNLRB1 MS Standard C13 and N15-labeled recombinant protein (NP_054902) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200051 |
Predicted MW | 10.9 kDa |
Protein Sequence |
>RC200051 protein sequence
Red=Cloning site Green=Tags(s) MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLR IRSKKNEIMVAPDKDYFLIVIQNPTE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_054902 |
RefSeq Size | 717 |
RefSeq ORF | 288 |
Synonyms | BITH; BLP; DNCL2A; DNLC2A; ROBLD1 |
Locus ID | 83658 |
Cytogenetics | 20q11.22 |
Summary | This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18. [provided by RefSeq, Aug 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402287 | DYNLRB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402287 | Transient overexpression lysate of dynein, light chain, roadblock-type 1 (DYNLRB1) |
CNY 3080.00 |
|
TP300051 | Recombinant protein of human dynein, light chain, roadblock-type 1 (DYNLRB1), 20 µg |
CNY 2900.00 |
其它DYNLRB1产品