DYNLRB1 (NM_014183) Human Recombinant Protein
CAT#: TP300051
Recombinant protein of human dynein, light chain, roadblock-type 1 (DYNLRB1), 20 µg
View other "DYNLRB1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200051 protein sequence
Red=Cloning site Green=Tags(s) MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLR IRSKKNEIMVAPDKDYFLIVIQNPTE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_054902 |
| Locus ID | 83658 |
| UniProt ID | Q9NP97 |
| Refseq Size | 717 |
| Cytogenetics | 20q11.22 |
| Refseq ORF | 288 |
| Synonyms | BITH; BLP; DNCL2A; DNLC2A; ROBLD1 |
| Summary | This gene is a member of the roadblock dynein light chain family. The encoded cytoplasmic protein is capable of binding intermediate chain proteins, interacts with transforming growth factor-beta, and has been implicated in the regulation of actin modulating proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 12 and 18. [provided by RefSeq, Aug 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402287 | DYNLRB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402287 | Transient overexpression lysate of dynein, light chain, roadblock-type 1 (DYNLRB1) |
CNY 3080.00 |
|
| PH300051 | DYNLRB1 MS Standard C13 and N15-labeled recombinant protein (NP_054902) |
CNY 19520.00 |
其它DYNLRB1产品
