C9orf95 (NMRK1) (NM_017881) Human Mass Spec Standard
CAT#: PH300160
C9orf95 MS Standard C13 and N15-labeled recombinant protein (NP_060351)
View other "C9orf95" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | C9orf95 MS Standard C13 and N15-labeled recombinant protein (NP_060351) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200160 |
Predicted MW | 23.2 kDa |
Protein Sequence |
>RC200160 protein sequence
Red=Cloning site Green=Tags(s) MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAI SCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSP GYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_060351 |
RefSeq Size | 1207 |
RefSeq ORF | 597 |
Synonyms | bA235O14.2; C9orf95; NRK1 |
Locus ID | 54981 |
Cytogenetics | 9q21.13 |
Summary | Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM, Mar 2008] |
Protein Pathways | Nicotinate and nicotinamide metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413502 | NMRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426819 | NMRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413502 | Transient overexpression lysate of chromosome 9 open reading frame 95 (C9orf95), transcript variant 1 |
CNY 3080.00 |
|
LY426819 | Transient overexpression lysate of chromosome 9 open reading frame 95 (C9orf95), transcript variant 2 |
CNY 3080.00 |
|
TP300160 | Recombinant protein of human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1, 20 µg |
CNY 2900.00 |
其它C9orf95产品