C9orf95 (NMRK1) (NM_017881) Human Recombinant Protein
CAT#: TP300160
Recombinant protein of human chromosome 9 open reading frame 95 (C9orf95), transcript variant 1, 20 µg
View other "C9orf95" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200160 protein sequence
Red=Cloning site Green=Tags(s) MKTFIIGISGVTNSGKTTLAKNLQKHLPNCSVISQDDFFKPESEIETDKNGFLQYDVLEALNMEKMMSAI SCWMESARHSVVSTDQESAEEIPILIIEGFLLFNYKPLDTIWNRSYFLTIPYEECKRRRSTRVYQPPDSP GYFDGHVWPMYLKYRQEMQDITWEVVYLDGTKSEEDLFLQVYEDLIQELAKQKCLQVTA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060351 |
Locus ID | 54981 |
UniProt ID | Q9NWW6 |
Refseq Size | 1207 |
Cytogenetics | 9q21.13 |
Refseq ORF | 597 |
Synonyms | bA235O14.2; C9orf95; NRK1 |
Summary | Nicotinamide adenine dinucleotide (NAD+) is essential for life in all organisms, both as a coenzyme for oxidoreductases and as a source of ADP-ribosyl groups used in various reactions. Nicotinic acid and nicotinamide, collectively known as niacin, are the vitamin precursors of NAD+. Nicotinamide riboside kinases, such as NRK1, function to synthesize NAD+ through nicotinamide mononucleotide using nicotinamide riboside as the precursor (Bieganowski and Brenner, 2004 [PubMed 15137942]).[supplied by OMIM, Mar 2008] |
Protein Pathways | Nicotinate and nicotinamide metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413502 | NMRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426819 | NMRK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413502 | Transient overexpression lysate of chromosome 9 open reading frame 95 (C9orf95), transcript variant 1 |
CNY 3080.00 |
|
LY426819 | Transient overexpression lysate of chromosome 9 open reading frame 95 (C9orf95), transcript variant 2 |
CNY 3080.00 |
|
PH300160 | C9orf95 MS Standard C13 and N15-labeled recombinant protein (NP_060351) |
CNY 19520.00 |
其它C9orf95产品