TRK fused gene (TFG) (NM_001007565) Human Mass Spec Standard
CAT#: PH300293
TFG MS Standard C13 and N15-labeled recombinant protein (NP_001007566)
View other "TRK fused gene" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | TFG MS Standard C13 and N15-labeled recombinant protein (NP_001007566) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200293 |
| Predicted MW | 43.4 kDa |
| Protein Sequence |
>RC200293 protein sequence
Red=Cloning site Green=Tags(s) MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFD SSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDT VDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSI ASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQT GPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMA PSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001007566 |
| RefSeq Size | 1841 |
| RefSeq ORF | 1200 |
| Synonyms | HMSNP; SPG57; TF6; TRKT3 |
| Locus ID | 10342 |
| Cytogenetics | 3q12.2 |
| Summary | There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Multiple transcript variants have been found for this gene. [provided by RefSeq, Sep 2010] |
| Protein Pathways | Pathways in cancer, Thyroid cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401827 | TFG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423514 | TFG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401827 | Transient overexpression lysate of TRK-fused gene (TFG), transcript variant 1 |
CNY 3080.00 |
|
| LY423514 | Transient overexpression lysate of TRK-fused gene (TFG), transcript variant 2 |
CNY 3080.00 |
|
| TP300293 | Recombinant protein of human TRK-fused gene (TFG), transcript variant 2, 20 µg |
CNY 2900.00 |
其它TRK fused gene产品
