TRK fused gene (TFG) (NM_001007565) Human Recombinant Protein
CAT#: TP300293
Recombinant protein of human TRK-fused gene (TFG), transcript variant 2, 20 µg
View other "TRK fused gene" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200293 protein sequence
Red=Cloning site Green=Tags(s) MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFD SSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDT VDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSI ASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQT GPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMA PSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001007566 |
Locus ID | 10342 |
UniProt ID | Q92734 |
Refseq Size | 1841 |
Cytogenetics | 3q12.2 |
Refseq ORF | 1200 |
Synonyms | HMSNP; SPG57; TF6; TRKT3 |
Summary | There are several documented fusion oncoproteins encoded partially by this gene. This gene also participates in several oncogenic rearrangements resulting in anaplastic lymphoma and mixoid chondrosarcoma, and may play a role in the NF-kappaB pathway. Multiple transcript variants have been found for this gene. [provided by RefSeq, Sep 2010] |
Protein Pathways | Pathways in cancer, Thyroid cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401827 | TFG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423514 | TFG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401827 | Transient overexpression lysate of TRK-fused gene (TFG), transcript variant 1 |
CNY 3080.00 |
|
LY423514 | Transient overexpression lysate of TRK-fused gene (TFG), transcript variant 2 |
CNY 3080.00 |
|
PH300293 | TFG MS Standard C13 and N15-labeled recombinant protein (NP_001007566) |
CNY 19520.00 |
其它TRK fused gene产品