Chemerin (RARRES2) (NM_002889) Human Mass Spec Standard
CAT#: PH300383
RARRES2 MS Standard C13 and N15-labeled recombinant protein (NP_002880)
View other "Chemerin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RARRES2 MS Standard C13 and N15-labeled recombinant protein (NP_002880) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200383 |
| Predicted MW | 18.6 kDa |
| Protein Sequence |
>RC200383 protein sequence
Red=Cloning site Green=Tags(s) MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR AGEDPHSFYFPGQFAFSKALPRS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002880 |
| RefSeq Size | 767 |
| RefSeq ORF | 489 |
| Synonyms | HP10433; TIG2 |
| Locus ID | 5919 |
| Cytogenetics | 7q36.1 |
| Summary | This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi. [provided by RefSeq, Nov 2014] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401013 | RARRES2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401013 | Transient overexpression lysate of retinoic acid receptor responder (tazarotene induced) 2 (RARRES2) |
CNY 3080.00 |
|
| TP300383 | Recombinant protein of human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2), 20 µg |
CNY 2900.00 |
其它Chemerin产品
