Chemerin (RARRES2) (NM_002889) Human Recombinant Protein
CAT#: TP300383
Recombinant protein of human retinoic acid receptor responder (tazarotene induced) 2 (RARRES2), 20 µg
View other "Chemerin" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 600.00
CNY 1050.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200383 protein sequence
Red=Cloning site Green=Tags(s) MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR AGEDPHSFYFPGQFAFSKALPRS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15.5 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002880 |
| Locus ID | 5919 |
| UniProt ID | Q99969 |
| Refseq Size | 767 |
| Cytogenetics | 7q36.1 |
| Refseq ORF | 489 |
| Synonyms | HP10433; TIG2 |
| Summary | This gene encodes a secreted chemotactic protein that initiates chemotaxis via the ChemR23 G protein-coupled seven-transmembrane domain ligand. Expression of this gene is upregulated by the synthetic retinoid tazarotene and occurs in a wide variety of tissues. The active protein has several roles, including that as an adipokine and as an antimicrobial protein with activity against bacteria and fungi. [provided by RefSeq, Nov 2014] |
| Protein Families | Druggable Genome, Nuclear Hormone Receptor, Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401013 | RARRES2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401013 | Transient overexpression lysate of retinoic acid receptor responder (tazarotene induced) 2 (RARRES2) |
CNY 3080.00 |
|
| PH300383 | RARRES2 MS Standard C13 and N15-labeled recombinant protein (NP_002880) |
CNY 19520.00 |
其它Chemerin产品
