PLPBP (NM_007198) Human Mass Spec Standard
CAT#: PH300853
PROSC MS Standard C13 and N15-labeled recombinant protein (NP_009129)
View other "PLPBP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
| Product Data | |
| Description | PROSC MS Standard C13 and N15-labeled recombinant protein (NP_009129) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200853 |
| Predicted MW | 30.3 kDa |
| Protein Sequence |
>RC200853 protein sequence
Red=Cloning site Green=Tags(s) MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYV QELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSWQRKGSPERLK VMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCK KLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_009129 |
| RefSeq Size | 2586 |
| RefSeq ORF | 825 |
| Synonyms | EPVB6D; PROSC |
| Locus ID | 11212 |
| Cytogenetics | 8p11.23 |
| Summary | This gene encodes a pyridoxal 5'-phosphate binding protein involved in the homeostatic regulation of intracellular pyridoxal 5'-phosphate. This gene has a tumor suppressive effect on hepatocellular carcinoma and other solid tumors of epithelial origin. Naturally occurring mutations in this gene are associated with a pyridoxine-dependent epilepsy. [provided by RefSeq, Mar 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416132 | PROSC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416132 | Transient overexpression lysate of proline synthetase co-transcribed homolog (bacterial) (PROSC) |
CNY 3080.00 |
|
| TP300853 | Recombinant protein of human proline synthetase co-transcribed homolog (bacterial) (PROSC), 20 µg |
CNY 2900.00 |
