PLPBP (NM_007198) Human Recombinant Protein
CAT#: TP300853
Recombinant protein of human proline synthetase co-transcribed homolog (bacterial) (PROSC), 20 µg
View other "PLPBP" proteins (3)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2900.00
CNY 6650.00
CNY 1999.00
CNY 2700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200853 protein sequence
Red=Cloning site Green=Tags(s) MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYV QELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSWQRKGSPERLK VMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCK KLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAADVKAPLEVAQEH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 30.2 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_009129 |
| Locus ID | 11212 |
| UniProt ID | O94903 |
| Refseq Size | 2586 |
| Cytogenetics | 8p11.23 |
| Refseq ORF | 825 |
| Synonyms | EPVB6D; PROSC |
| Summary | This gene encodes a pyridoxal 5'-phosphate binding protein involved in the homeostatic regulation of intracellular pyridoxal 5'-phosphate. This gene has a tumor suppressive effect on hepatocellular carcinoma and other solid tumors of epithelial origin. Naturally occurring mutations in this gene are associated with a pyridoxine-dependent epilepsy. [provided by RefSeq, Mar 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416132 | PROSC HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416132 | Transient overexpression lysate of proline synthetase co-transcribed homolog (bacterial) (PROSC) |
CNY 3080.00 |
|
| PH300853 | PROSC MS Standard C13 and N15-labeled recombinant protein (NP_009129) |
CNY 19520.00 |
