DNA Polymerase epsilon (POLE3) (NM_017443) Human Mass Spec Standard
CAT#: PH300874
POLE3 MS Standard C13 and N15-labeled recombinant protein (NP_059139)
View other "DNA Polymerase epsilon" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | POLE3 MS Standard C13 and N15-labeled recombinant protein (NP_059139) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC200874 | 
| Predicted MW | 16.9 kDa | 
| Protein Sequence | 
                 >RC200874 protein sequence 
Red=Cloning site Green=Tags(s) MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVL SAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQN EEEEVDN myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_059139 | 
| RefSeq Size | 2288 | 
| RefSeq ORF | 441 | 
| Synonyms | CHARAC17; CHRAC2; CHRAC17; p17; YBL1 | 
| Locus ID | 54107 | 
| Cytogenetics | 9q32 | 
| Summary | POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004] | 
| Protein Pathways | Base excision repair, DNA replication, Metabolic pathways, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC413749 | POLE3 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY413749 | Transient overexpression lysate of polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3) | 
                                                     CNY 3080.00  | 
                                            |
| TP300874 | Recombinant protein of human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
其它DNA Polymerase epsilon产品
