DNA Polymerase epsilon (POLE3) (NM_017443) Human Recombinant Protein
CAT#: TP300874
Recombinant protein of human polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3), 20 µg
View other "DNA Polymerase epsilon" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
                    Avi-tag Biotinylated Protein  Get a free quote  | 
CNY 2900.00
CNY 6650.00
| Cited in 1 publication. | 
CNY 600.00
Specifications
| Product Data | |
| Species | Human | 
| Expression Host | HEK293T | 
| Expression cDNA Clone or AA Sequence | 
                 >RC200874 protein sequence 
Red=Cloning site Green=Tags(s) MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVL SAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQN EEEEVDN myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Predicted MW | 16.7 kDa | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol | 
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. | 
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. | 
| Storage | Store at -80°C. | 
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. | 
| Reference Data | |
| RefSeq | NP_059139 | 
| Locus ID | 54107 | 
| UniProt ID | Q9NRF9 | 
| Refseq Size | 2288 | 
| Cytogenetics | 9q32 | 
| Refseq ORF | 441 | 
| Synonyms | CHARAC17; CHRAC2; CHRAC17; p17; YBL1 | 
| Summary | POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM, Apr 2004] | 
| Protein Pathways | Base excision repair, DNA replication, Metabolic pathways, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism | 
Citations (1)
| The use of this Proteins has been cited in the following citations: | 
|---|
| 
                                                Moderate UV Exposure Enhances Learning and Memory by Promoting a Novel Glutamate Biosynthetic Pathway in the Brain.
                                                ,null,
                                                Cell
                                                ,PubMed ID 29779945
                                                [POLE3]
                                                 | 
                                        
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC413749 | POLE3 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY413749 | Transient overexpression lysate of polymerase (DNA directed), epsilon 3 (p17 subunit) (POLE3) | 
                                                     CNY 3080.00  | 
                                            |
| PH300874 | POLE3 MS Standard C13 and N15-labeled recombinant protein (NP_059139) | 
                                                     CNY 19520.00  | 
                                            
其它DNA Polymerase epsilon产品
