PRAS40 (AKT1S1) (NM_032375) Human Mass Spec Standard
CAT＃: PH300919
AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_115751)
View other "PRAS40" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_115751) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC200919 |
| Predicted MW | 27.2 kDa |
| Protein Sequence |
>RC200919 representing NM_032375
Red=Cloning site Green=Tags(s) MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYPAHGRGALAEAARRCLHDIALAHR AATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQLGISDNGGLFVMDEDATLQDL PPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQYAKSLPVSVPVWGFKEKRTEARSSDEENGPP SSPDLDRIAASMRALVLREAEDTQVFGDLPRPRLNTSDFQKLKRKY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115751 |
| RefSeq Size | 2344 |
| RefSeq ORF | 768 |
| Synonyms | Lobe; PRAS40 |
| Locus ID | 84335 |
| Cytogenetics | 19q13.33 |
| Summary | AKT1S1 is a proline-rich substrate of AKT (MIM 164730) that binds 14-3-3 protein (see YWHAH, MIM 113508) when phosphorylated (Kovacina et al., 2003 [PubMed 12524439]).[supplied by OMIM, Mar 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410168 | AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420655 | AKT1S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410168 | Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1 |
CNY 3080.00 |
|
| LY420655 | Transient overexpression lysate of AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2 |
CNY 3080.00 |
|
| PH311995 | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092102) |
CNY 19520.00 |
|
| PH312216 | AKT1S1 MS Standard C13 and N15-labeled recombinant protein (NP_001092103) |
CNY 19520.00 |
|
| TP300919 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP311995 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP312216 | Recombinant protein of human AKT1 substrate 1 (proline-rich) (AKT1S1), transcript variant 3, 20 µg |
CNY 2900.00 |
