PDZD11 (NM_016484) Human Mass Spec Standard
CAT#: PH301049
PDZD11 MS Standard C13 and N15-labeled recombinant protein (NP_057568)
View other "PDZD11" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PDZD11 MS Standard C13 and N15-labeled recombinant protein (NP_057568) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201049 |
Predicted MW | 16.1 kDa |
Protein Sequence |
>RC201049 protein sequence
Red=Cloning site Green=Tags(s) MDSRIPYDDYPVVFLPAYENPPAWIPPHERVHHPDYNNELTQFLPRTITLKKPPGAQLGFNIRGGKASQL GIFISKVIPDSDAHRAGLQEGDQVLAVNDVDFQDIEHSKAVEILKTAREISMRVRFFPYNYHRQKERTVH myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057568 |
RefSeq Size | 1246 |
RefSeq ORF | 420 |
Synonyms | AIPP1; PDZK11; PISP |
Locus ID | 51248 |
Cytogenetics | Xq13.1 |
Summary | Mediates docking of ADAM10 to zonula adherens by interacting with PLEKHA7 which is required for PLEKHA7 to interact with the ADAM10-binding protein TSPAN33.[UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413926 | PDZD11 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413926 | Transient overexpression lysate of PDZ domain containing 11 (PDZD11) |
CNY 3080.00 |
|
TP301049 | Recombinant protein of human PDZ domain containing 11 (PDZD11), 20 µg |
CNY 2900.00 |